PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10023504
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 1638aa    MW: 177763 Da    PI: 6.3241
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10023504genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.7e-08796836446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      WT eE +++++  +  G++ +k+Ia+ +  ++t  +c+++++k
      Lus10023504 796 WTSEERQIFINKLASCGKD-FKKIASFLE-HKTTADCVEFYYK 836
                      *****************99.*********.***********98 PP

2Myb_DNA-binding28.82.9e-0910031042445
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                       WT  E   +v+av ++G++ +++++r+++ +R+  qck ++ 
      Lus10023504 1003 WTDKEKSAFVQAVSLYGKN-FALVSRCVQ-TRSQDQCKVFFS 1042
                       *****************99.*********.********8775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.58E-13779841IPR009057Homeodomain-like
PROSITE profilePS5129315.417791842IPR017884SANT domain
SMARTSM007175.5E-8792840IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-5795836IPR009057Homeodomain-like
PfamPF002499.3E-6796836IPR001005SANT/Myb domain
PROSITE profilePS5129311.1549981049IPR017884SANT domain
SuperFamilySSF466892.42E-99981048IPR009057Homeodomain-like
SMARTSM007171.4E-79991047IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-510021043IPR009057Homeodomain-like
PfamPF002494.8E-710031041IPR001005SANT/Myb domain
CDDcd001671.65E-510031041No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1638 aa     Download sequence    Send to blast
MPPEPFSLDR KKHERSESSS SSLGSAPRWR EWSSGHYGPY RELGPRWAGG SGELRRPSGH  60
GKQGWHLSPE QSGYGYTRSR SSDRMQEDEN GRLPFSRVDG KYGRTSRDNR GLSGPRDCKT  120
HSWEISNGSP IGPGRSHDVS NGQRSVDDML THPPYSDFVN TWNQLQLKEH HDRNNEQGTN  180
VLTSGQRGEK ANSLDWEPLK WARGGSLSSR GSGFRYSSSS KSIGAVDSNG GKNEVLPLDN  240
VTSIQSPSRD AAATDGNSAA PSDETTSRKK PRLTWGQGLA KFEKKRGEGP EISGTRDDRP  300
LFAMNADPVH SQSSSLVDRS PRLMGFPDSP ATPSSVACSS SPGTEEKFPV KALGIDNDAS  360
NLYGSPYANS QSHLEELSLD IEKLDSSLIT TLGSSLTEMI QSDNLCSADS SSVKLAGMRK  420
LLVWKGDVLK ALETAESEID MLENELKLLK SDSKSKLSCP SPSSSLLNGG AIVCNELKNV  480
SGNALCRPST LKVVSSRDEI HNSDDSFDGD GGAKDDADSP GTATSKFVEL VSSTRISSEM  540
LICDEQSGLC PAEHSSLDLK VAVPVAQEKD FPVSASEVNF LVHCNTSKPV YASRSSVANG  600
EDYLCTAILS SNKVSASAAA DEFNRLLPSD PCSVDCSRVA NILSLQYDAL IEQIFLMRKR  660
PIKLKEKVVA LKFKAFQHLW REDMRSLSVK KSKSKFQKKF ESSSRPIFHM DKKHRSSSRL  720
RVCLSGNLGL VPSPDVLKFT RKLLADCNVK VYRDKLKMPA QILDEKEKVA SRFISGNGLV  780
EDPCAVERER AMINLWTSEE RQIFINKLAS CGKDFKKIAS FLEHKTTADC VEFYYKNHKS  840
ESFGKMKKNK QSNSSANYLM SSNKKWNREM NAAPLEILSA GSVLASDSGR SMASRKMQTG  900
RMLIRGPGNC TIMEDGDCNS DRSNNYDMIV SERETAAADV LAGISGSVSS CITTADRGEG  960
FHEFKSQKRA TVDRCVSLSD ATQSVDEETC SDNSCGEMNP ADWTDKEKSA FVQAVSLYGK  1020
NFALVSRCVQ TRSQDQCKVF FSKSRKCLAL DQIQSCKDVV GPSVVEDASG GGSDMEHGNV  1080
LEKGLNKPSS EVDCDLPSSD MFTAGVSNLE SNLHISEDKE VAGAMEVAGL LNANALVSDC  1140
PKDHLLQSSL LADGEVINGS ESSIKGQKVR IEPGVIESEK DRGASDGFAN SGIAEDVVDS  1200
APTNLVSSFE DEARKEVPVS LGNQEISFPH PKTSSQSLIQ DLNTTKEVQH PPWDMGSSND  1260
GHGVENINQR QVEVNSVETS AAMSLPMESN MASTDSVIQD SAAVHDSGGI SASVDVHQNG  1320
ERDDAKFYEN GDVLHLLSVG ESSQIITKQF VAEGPHLQKP SNSEGQCSAT ELSLLSQHSE  1380
QVNRQSHSSS DMEKPCRNGD VKLFGKILSN TASSSHKPNT EYGKDGKSSH PVETGSPATL  1440
NFTGHPSTDG NATLLNFDPN SCAGSENLLP QRSYGLWDGR RIRMGVSSLP DSAILLAKYP  1500
DAFSNYQGHP AKILTNSERS INGLLKFPSR DAGSSSTALL DLQRYITQDA NKFKPFALER  1560
QEVLDLQARK GFDSIPSLQQ QGRAMGGVLI GGPCQAISDP VAAIKMHFAK TDRVGVQSGT  1620
VNPRQDEPWR GQGDARR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-14758843993NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-14758843993NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086506.10.0PREDICTED: uncharacterized protein LOC105645502
TrEMBLA0A067K1T60.0A0A067K1T6_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49863352
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-160MYB family protein